PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G283600.1
Common NamePHAVU_002G283600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NAC
Protein Properties Length: 235aa    MW: 26479.8 Da    PI: 8.5446
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G283600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.12.6e-47141411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF+Ptdeelv +yLk kv + +l++ ++i+e++++k++PwdLp ++  + +e yfFs+++ ky++g+r nr+tk gyWkatg+dk+
  Phvul.002G283600.1  14 LPPGFRFQPTDEELVFQYLKCKVFSYPLPA-SIIPEINVCKHDPWDLPGNC--DPQERYFFSPKEAKYRNGNRMNRTTKCGYWKATGSDKR 101
                         79****************************.89***************544..67899********************************* PP

                 NAM  92 vlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + s+    +  vg++ktL+fy+g++pkg++tdWv+heyrl
  Phvul.002G283600.1 102 ISSSsnaCNGIVGIRKTLIFYEGKSPKGSRTDWVLHEYRL 141
                         **985555556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-5510170IPR003441NAC domain
PROSITE profilePS5100552.94114170IPR003441NAC domain
PfamPF023651.8E-2415141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEKLNFVKNG VSKLPPGFRF QPTDEELVFQ YLKCKVFSYP LPASIIPEIN VCKHDPWDLP  60
GNCDPQERYF FSPKEAKYRN GNRMNRTTKC GYWKATGSDK RISSSSNACN GIVGIRKTLI  120
FYEGKSPKGS RTDWVLHEYR LVNAETGACN SSHNYVNEIG DWVLCRLSMK KRSIESGVDE  180
KQRVHNGPRL MFDFMMLGKT DSSTSSSCSS SNNIMEVSSN ASDHEETSGG YAYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-481417517170NO APICAL MERISTEM PROTEIN
1ut4_B6e-481417517170NO APICAL MERISTEM PROTEIN
1ut7_A6e-481417517170NO APICAL MERISTEM PROTEIN
1ut7_B6e-481417517170NO APICAL MERISTEM PROTEIN
3swm_A7e-481417520173NAC domain-containing protein 19
3swm_B7e-481417520173NAC domain-containing protein 19
3swm_C7e-481417520173NAC domain-containing protein 19
3swm_D7e-481417520173NAC domain-containing protein 19
3swp_A7e-481417520173NAC domain-containing protein 19
3swp_B7e-481417520173NAC domain-containing protein 19
3swp_C7e-481417520173NAC domain-containing protein 19
3swp_D7e-481417520173NAC domain-containing protein 19
4dul_A6e-481417517170NAC domain-containing protein 19
4dul_B6e-481417517170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-129AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159989.11e-177hypothetical protein PHAVU_002G283600g
SwissprotQ9FY932e-71NAC83_ARATH; NAC domain-containing protein 83
TrEMBLV7CRJ91e-177V7CRJ9_PHAVU; Uncharacterized protein
STRINGGLYMA05G38380.11e-145(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-71NAC domain containing protein 83